20210801 20180803 20180328 20210801 IID00202 Homeobox protein goosecoid Homo sapiens 257 P56915 Q86YR1 Regulates chordin (CHRD). May play a role in spatial programing within discrete embryonic fields or lineage compartments during organogenesis. In concert with NKX3-2, plays a role in defining the structural components of the middle ear; required for the development of the entire tympanic ring (By similarity). Probably involved in the regulatory networks that define neural crest cell fate specification and determine mesoderm cell lineages in mammals. Nucleus. SL-0191 unkown eh1 5 13 GSC GSC_HUMAN MPASMFSIDNILAARPRCKDSVLPVAHSAAAPVVFPALHGDSLYGASGGASSDYGAFYPRPVAPGGAGLPAAVSGSRLGYNNYFYGQLHVQAAPVGPACCGAVPPLGAQQCSCVPTPPGYEGPGSVLVSPVPHQMLPYMNVGTLSRTELQLLNQLHCRRKRRHRTIFTDEQLEALENLFQETKYPDVGTREQLARKVHLREEKVEVWFKNRRAKWRRQKRSSSEESENAEKWNKTSSSKASPEKREEEGKSDLDSDS 1 2dmuA 161 217 order 1 2 2dmuA 161 165 high_rmsd 1 1 2dmu NMR S.OHNISHI,M.SATO,S.KOSHIBA,M.INOUE,T.KIGAWA,S.YOKOYAMA TO BE PUBLISHED nmr 2dmu A 161 217 100 0 1 2dmu 3534 Monomer monomer 2dmuA P56915 IID00202 5-5,7-10,12-13,134-134,142-155,162-221,253-253,255-256 1-4,6-6,11-11,14-133,135-141,156-161,222-252,254-254,257-257 165-210 1-164,211-257 4-15,34-41,51-57,79-84,113-122,161-164,211-218 40-56,59-76,221-227